CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GG14938 *(Drosophila erecta)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	FBgn0107192	T038598_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Clk M05972_2.00	Drosophila melanogaster	MCACGTGV	BCACGTGK	B1H Zhu et al.(2011) Clk_cyc_SANGER_5_FBgn0023076	0.914	0.960
Clk M05973_2.00	Drosophila melanogaster	CACGTGSY	RSCACGTG	B1H Zhu et al.(2011) gce_Clk_SANGER_5_FBgn0023076	0.914	0.960
Clk M05974_2.00	Drosophila melanogaster	CACGTGKM	KACACGTG	B1H Zhu et al.(2011) Met_Clk_SANGER_5_FBgn0023076	0.914	0.960
Clk M05975_2.00	Drosophila melanogaster	SACACGTGY	RCACGTGTS	B1H Zhu et al.(2011) tai_Clk_SANGER_5_FBgn0023076	0.914	0.960
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
FBpp0133484	bHLH	16	65	CRKSRNLSEKKRRDQFNSLVNDLSALISTTSRKMDKSTVLKSTIAFLKNH

Links
Other bHLH family TFs
Other *Drosophila erecta* TFs