CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Pvit_07605 *(Pogona vitticeps)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Pvit_07605	T047722_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Clock M01735_2.00	Mus musculus	NNCAYRTGNN	NNCAYRTGNN	PBM Weirauch et al.(2014) pTH5056	0.914	1.000
CLOCK M02789_2.00	Homo sapiens	DACACGTGYH	DRCACGTGTH	SELEX Jolma et al.(2013) CLOCK_1	0.914	1.000
CLOCK M04129_2.00	Homo sapiens	NMCACGTGYN	NRCACGTGKN	SELEX Yin et al.(2017) CLOCK_eDBD_HT-SELEX	0.914	1.000
CLOCK M08728_2.00	Homo sapiens	DBBBCAYKTGNNHB	VDNNCAMRTGVVVH	Misc Kulakovskiy et al.(2013) CLOCK_HUMAN.H11MO.0.C	0.914	1.000
Clock M08760_2.00	Mus musculus	DBBBCAYKTGNNHB	VDNNCAMRTGVVVH	Misc Kulakovskiy et al.(2013) CLOCK_MOUSE.H11MO.0.C	0.914	1.000
Clock M09473_2.00	Mus musculus	CACGTGNN	NNCACGTG	Misc Heinz et al.(2010) Liver-Clock_GSE39860	0.914	1.000
CLOCK M09849_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CLOCK_Q6	0.914	1.000
CLOCK M04130_2.00	Homo sapiens	NRCRCRTGBH	DVCAYGYGYN	SELEX Yin et al.(2017) CLOCK_eDBD_Methyl-HT-SELEX	0.914	1.000
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pvit_07605	bHLH	35	85	KRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHK

Links
Other bHLH family TFs
Other *Pogona vitticeps* TFs

77 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
ARB_02530	Arthroderma benhamiae	ARB_02530	N
MCYG_08336	Arthroderma otae	MCYG_08336	N
MCYG_08336	Microsporum canis	MCYG_08336	N
MGYG_05744	Microsporum gypseum	MGYG_05744	N
H101_01466	Trichophyton interdigitale	H101_01466	N
H102_07272	Trichophyton rubrum	H102_07272	N
H105_07310	Trichophyton soudanense	H105_07310	N
TESG_01974	Trichophyton tonsurans	TESG_01974	N
TRV_05175	Trichophyton verrucosum	TRV_05175	N