CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Pm015434 *(Prunus mume)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	Pm015434	T070369_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ATBZIP42 M06775_2.00	Arabidopsis thaliana	TGCTGACGTGGM	KCCACGTCAGCA	Dap-seq OMalley et al.(2016) bZIP42_col_a	0.876	0.903
ATBZIP42 M06776_2.00	Arabidopsis thaliana	TGCTGACGTGGCV	BGCCACGTCAGCA	Dap-seq OMalley et al.(2016) bZIP42_colamp_a	0.876	0.903
OS02G0728001 M01826_2.00	Oryza sativa	NHCACGTGKNN	NNMCACGTGDN	PBM Weirauch et al.(2014) pTH8334	0.802	0.677
OS02G0728001 M01827_2.00	Oryza sativa	WSACGTGG	CCACGTSW	PBM Weirauch et al.(2014) pTH8737	0.802	0.677
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pm015434	bZIP	85	146	NERKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSESHDKVLQENA

Links
Other bZIP family TFs
Other *Prunus mume* TFs