CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

fgeneshMC_pg.2_#_504 *(Mucor circinelloides)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	fgeneshMC_pg.2_#_504	T071099_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ANIA_04562 M01137_2.00	Aspergillus nidulans	BMTKABDHAD	HTDHVTMAKV	PBM Lambert et al.(2019) pEX0236	0.812	0.623
NCU01994 M01834_2.00	Neurospora crassa	DMTKAYDWNN	NNWHRTMAKH	PBM Weirauch et al.(2014) pTH9664	0.792	0.557
YAP3 M00013_2.00	Saccharomyces cerevisiae	NNTTACKWAD	HTWMGTAANN	PBM Badis et al.(2008) YAP3_4535	0.784	0.475
YAP3 M00905_2.00	Saccharomyces cerevisiae	NTWMGTAATNN	NNATTACKWAN	PBM Gordan et al.(2011) Yap3	0.784	0.475
YAP3 M07443_2.00	Saccharomyces cerevisiae	HACGTAAK	MTTACGTD	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0416.1	0.784	0.475
YAP3 M08497_2.00	Saccharomyces cerevisiae	TTAYSTAA	TTASRTAA	Misc DeBoer et al.(2011) YHL009C_1411	0.784	0.475
YAP3 M08498_2.00	Saccharomyces cerevisiae	TTACTAA	TTAGTAA	Misc DeBoer et al.(2011) YHL009C_672	0.784	0.475
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
fgeneshMC_pg.2_#_504	bZIP	115	180	NPKSKRKAQNRAAQRAFRERKENHVRILEDRVKELEKELNLDKNSKLLMENEKLKEMITRLQNENA

Links
Other bZIP family TFs
Other *Mucor circinelloides* TFs