CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

AGOS_ABR058C *(Ashbya gossypii)* Copper fist
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00649 (Copper-fist)	IPR001083	AGOS_ABR058C	T163701_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MAC1 M08552_2.00	Saccharomyces cerevisiae	TTTGCTCR	YGAGCAAA	Misc DeBoer et al.(2011) YMR021C_1540	0.795	0.795
MAC1 M10409_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$MAC1_Q6_01	0.795	0.795
MAC1 M10410_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$MAC1_Q6	0.795	0.795
MAC1 M08454_2.00	Saccharomyces cerevisiae	TTTGCTCR	YGAGCAAA	COMPILED Mathelier et al.(2014) MA0326.1	0.795	0.795
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AAS50828	Copper fist	2	40	IIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPS

Links
Other Copper fist family TFs
Other *Ashbya gossypii* TFs