CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

RO3G_05383 *(Rhizopus oryzae)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00320 (GATA)	IPR000679	RO3G_05383	T191461_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
GLN3 M00048_2.00	Saccharomyces cerevisiae	NHGATAAS	STTATCDN	PBM Badis et al.(2008) GLN3_2032	0.818	0.714
GLN3 M01545_2.00	Saccharomyces cerevisiae	HGATARN	NYTATCD	PBM Zhu et al.(2009) Gln3	0.818	0.714
GLN3 M07477_2.00	Saccharomyces cerevisiae	GATWR	YWATC	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0307.1	0.818	0.714
GLN3 M08559_2.00	Saccharomyces cerevisiae	GATWR	YWATC	Misc DeBoer et al.(2011) YER040W_539	0.818	0.714
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
RO3T_05382	GATA	130	164	CYHCQTTNTPLWRRSPEGAVLCNACGLFLKLHGVV

Links
Other GATA family TFs
Other *Rhizopus oryzae* TFs