CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

22393_YLR013W *(Saccharomyces mikatae)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00320 (GATA)	IPR000679	22393_YLR013W	T197013_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
GAT4 M00050_2.00	Saccharomyces cerevisiae	NNAGATCTMN	NKAGATCTNN	PBM Badis et al.(2008) GAT4_4527	0.836	0.722
GAT4 M01547_2.00	Saccharomyces cerevisiae	NNNRWWYNNN	NNNRWWYNNN	PBM Zhu et al.(2009) Gat4	0.836	0.722
GAT4 M07479_2.00	Saccharomyces cerevisiae	NNAGATCYNNN	NNNRGATCTNN	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0302.1	0.836	0.722
GAT4 M08561_2.00	Saccharomyces cerevisiae	NNAGATCYNNN	NNNRGATCTNN	Misc DeBoer et al.(2011) YIR013C_565	0.836	0.722
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
22393_YLR013W	GATA	69	105	CNQCKETKTSSQWREGPTGGSCLCNACGLFYRKLFLA

Links
Other GATA family TFs
Other *Saccharomyces mikatae* TFs