CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GA13896 *(Drosophila pseudoobscura)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	FBgn0073928	T217553_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
CG15696 M02125_2.00	Drosophila melanogaster	NNYWATHNN	NNDATWRNN	PBM Weirauch et al.(2014) pTH6445	0.865	0.930
CG15696 M06540_2.00	Drosophila melanogaster	TTRATTR	YAATYAA	B1H Mathelier et al.(2014) MA0176.1	0.865	0.930
CG15696 M06356_2.00	Drosophila melanogaster	BTTRATTR	YAATYAAV	B1H Zhu et al.(2011) CG15696_Cell_FBgn0038833	0.865	0.930
CG15696 M06357_2.00	Drosophila melanogaster	NHTWATTR	YAATWADN	B1H Zhu et al.(2011) CG15696_SOLEXA_FBgn0038833	0.865	0.930
NEMVEDRAFT_v1g80394 M02151_2.00	Nematostella vectensis	NNYWATNHN	NDNATWRNN	PBM Weirauch et al.(2014) pTH5904	0.727	0.544
Esx1 M00424_2.00	Mus musculus	NYTAATWR	YWATTARN	PBM Berger et al.(2008) Esx1_3124	0.619	0.474
CAD25284 M02053_2.00	Encephalitozoon cuniculi	YTAATTAB	VTAATTAR	PBM Weirauch et al.(2014) pTH6265	0.611	0.333
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
FBpp0282131	Homeodomain	94	150	RLPRIPFTPAQLQALESAYKESNYLSAEDANKLAESLDLTNTRVKIWFQNRRARERR

Links
Other Homeodomain family TFs
Other *Drosophila pseudoobscura* TFs