CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

WOX1 *(Vitis vinifera)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	VIT_01s0011g05020	T224511_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WUS M06905_2.00	Arabidopsis thaliana	TRAWTGAWTGA	TCAWTCAWTYA	Dap-seq OMalley et al.(2016) WUS1_col_a	0.739	0.719
WUS M06906_2.00	Arabidopsis thaliana	TGAWTGAWTGW	WCAWTCAWTCA	Dap-seq OMalley et al.(2016) WUS1_colamp_a	0.739	0.719
WOX13 M02049_2.00	Arabidopsis thaliana	YTGATTGA	TCAATCAR	PBM Weirauch et al.(2014) pTH6461	0.618	0.439
WOX13 M00866_2.00	Arabidopsis thaliana	NNTGATTGAN	NTCAATCANN	PBM Franco-Zorrilla et al.(2014) WOX13	0.618	0.439
GRMZM2G038252 M02137_2.00	Zea mays	HTRATTGV	BCAATYAD	PBM Weirauch et al.(2014) pTH6141	0.618	0.439
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
VIT_01s0011g05020.t01	Homeodomain	70	131	GSSRWNPTPEQLQALEELYRRGTRTPTAEQIQQIAAQLRLFGKIEGKNVFYWFQNHKARERQ

Links
Other Homeodomain family TFs
Other *Vitis vinifera* TFs