CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Lus10035583.g *(Linum usitatissimum)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00046 (Homeobox)	IPR001356	Lus10035583.g	T228929_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ATHB-51 M00867_2.00	Arabidopsis thaliana	ATWATKNN	NNMATWAT	PBM Franco-Zorrilla et al.(2014) ATHB51	0.787	0.825
ATHB-51 M06927_2.00	Arabidopsis thaliana	DNCAATAATTGAD	HTCAATTATTGNH	Dap-seq OMalley et al.(2016) LMI1_col_a	0.787	0.825
ATHB-51 M06928_2.00	Arabidopsis thaliana	NDNCAATAATTGA	TCAATTATTGNHN	Dap-seq OMalley et al.(2016) LMI1_colamp_a	0.787	0.825
ATHB-22 M02041_2.00	Arabidopsis thaliana	NNATAATWWWNNN	NNNWWWATTATNN	PBM Weirauch et al.(2014) pTH5883	0.753	0.684
PK20392.1 M01250_2.00	Cannabis sativa	NHAATMATDN	NHATKATTDN	PBM Lambert et al.(2019) pTH11331	0.689	0.579
PK20392.1 M01251_2.00	Cannabis sativa	NHAATMATDN	NHATKATTDN	PBM Lambert et al.(2019) pTH11332	0.689	0.579
ATHB-20 M06912_2.00	Arabidopsis thaliana	HYAATAATTRD	HYAATTATTRD	Dap-seq OMalley et al.(2016) ATHB20_col_a	0.669	0.561
ATHB-20 M06913_2.00	Arabidopsis thaliana	HYAATMATTRD	HYAATKATTRD	Dap-seq OMalley et al.(2016) ATHB20_colamp_a	0.669	0.561
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Lus10035583	Homeodomain	56	112	DQKKKRLTNHQLESLETNFQEEIKLDPDRKMKLSRELGLHPRQIAVWFQNRRARWKA

Links
Other Homeodomain family TFs
Other *Linum usitatissimum* TFs