CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Solyc10g079380.1 *(Solanum lycopersicum)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00447 (HSF_DNA-bind)	IPR000232	Solyc10g079380.1	T242128_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFB3 M06937_2.00	Arabidopsis thaliana	RRAANMWTCTAGAAV	BTTCTAGAWKNTTYY	Dap-seq OMalley et al.(2016) HSFB3_col_a	0.451	0.736
HSFB3 M06938_2.00	Arabidopsis thaliana	AABSTTCTAGAAN	NTTCTAGAASVTT	Dap-seq OMalley et al.(2016) HSFB3_colamp_a	0.451	0.736
HSFB2B M06945_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_col_a	0.415	0.713
HSFB2B M06946_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_colamp_a	0.415	0.713
HSFB2A M00869_2.00	Arabidopsis thaliana	NNNNNTTCB	VGAANNNNN	PBM Franco-Zorrilla et al.(2014) HSFB2A	0.392	0.678
HSFB2A M06952_2.00	Arabidopsis thaliana	GAANNTTCYAGA	TCTRGAANNTTC	Dap-seq OMalley et al.(2016) HSF6_col_a	0.392	0.678
HSFB4 M06936_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFB4_col_a	0.384	0.644
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.362	0.575
HSFC1 M00868_2.00	Arabidopsis thaliana	NDTCBNNN	NNNVGAHN	PBM Franco-Zorrilla et al.(2014) HSFC1	0.353	0.529
HSFC1 M06943_2.00	Arabidopsis thaliana	GAASNTTCTAG	CTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFC1_col_a	0.353	0.529
HSFC1 M06944_2.00	Arabidopsis thaliana	RGAASNTTCTAGAANVW	WBNTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFC1_colamp_a	0.353	0.529
HSFA1E M06939_2.00	Arabidopsis thaliana	RGAANNTTCTAGA	TCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSFA1E_col_a	0.323	0.563
HSFA1E M06940_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA1E_colamp_a	0.323	0.563
HSFA6A M06950_2.00	Arabidopsis thaliana	GAASNTTCTAGAANNW	WNNTTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_col_a	0.321	0.575
HSFA6A M06951_2.00	Arabidopsis thaliana	GAASNTTCTAGAA	TTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_colamp_a	0.321	0.575
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Solyc10g079380.1.1	HSF	24	114	FLLKTYMLVEDPATDDVISWNSDGSAFIVRQPAEFARDLLPTLFKHSNFSSFVRQLNTYGFRKITTNQWEFSNDLFRKGDKDLLCDIRRKK

Links
Other HSF family TFs
Other *Solanum lycopersicum* TFs

1060 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Solyc10g079380.1 (Solanum lycopersicum) HSF

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

1060 Related TFs

Solyc10g079380.1 **(Solanum lycopersicum)
HSF**