CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Cucsa.016480 *(Cucumis sativus)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	Cucsa.016480	T242746_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA6B M06941_2.00	Arabidopsis thaliana	RGAASNTTCTAGA	TCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA6B_colamp_a	0.501	0.759
HSFA6B M06942_2.00	Arabidopsis thaliana	RGAABNTTCTRGAAN	NTTCYAGAANVTTCY	Dap-seq OMalley et al.(2016) HSFA6B_col	0.501	0.759
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.436	0.690
HSFC1 M00868_2.00	Arabidopsis thaliana	NDTCBNNN	NNNVGAHN	PBM Franco-Zorrilla et al.(2014) HSFC1	0.435	0.667
HSFC1 M06943_2.00	Arabidopsis thaliana	GAASNTTCTAG	CTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFC1_col_a	0.435	0.667
HSFC1 M06944_2.00	Arabidopsis thaliana	RGAASNTTCTAGAANVW	WBNTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFC1_colamp_a	0.435	0.667
HSFB4 M06936_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFB4_col_a	0.428	0.667
HSFA1E M06939_2.00	Arabidopsis thaliana	RGAANNTTCTAGA	TCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSFA1E_col_a	0.426	0.655
HSFA1E M06940_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA1E_colamp_a	0.426	0.655
HSFA6A M06950_2.00	Arabidopsis thaliana	GAASNTTCTAGAANNW	WNNTTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_col_a	0.417	0.667
HSFA6A M06951_2.00	Arabidopsis thaliana	GAASNTTCTAGAA	TTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_colamp_a	0.417	0.667
HSFB2A M00869_2.00	Arabidopsis thaliana	NNNNNTTCB	VGAANNNNN	PBM Franco-Zorrilla et al.(2014) HSFB2A	0.416	0.644
HSFB2A M06952_2.00	Arabidopsis thaliana	GAANNTTCYAGA	TCTRGAANNTTC	Dap-seq OMalley et al.(2016) HSF6_col_a	0.416	0.644
HSFA1B M06948_2.00	Arabidopsis thaliana	GAANNTTCTAGA	TCTAGAANNTTC	Dap-seq OMalley et al.(2016) HSF3_col_a	0.412	0.667
HSFA1B M06949_2.00	Arabidopsis thaliana	TTCYRG	CYRGAA	Dap-seq OMalley et al.(2016) HSF3_colamp_a	0.412	0.667
HSFB2B M06945_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_col_a	0.405	0.632
HSFB2B M06946_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_colamp_a	0.405	0.632
HSFB3 M06937_2.00	Arabidopsis thaliana	RRAANMWTCTAGAAV	BTTCTAGAWKNTTYY	Dap-seq OMalley et al.(2016) HSFB3_col_a	0.387	0.575
HSFB3 M06938_2.00	Arabidopsis thaliana	AABSTTCTAGAAN	NTTCTAGAASVTT	Dap-seq OMalley et al.(2016) HSFB3_colamp_a	0.387	0.575
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cucsa.016480.1	HSF	43	133	FLIKTFDIVDDPLTDHIISWGRGGISFIVWDPKAFSANLLPRFFKHNNFSSFIRQLNTYGFRKINPERWEFANEGFLRGQKHLLRTIKRRK

Links
Other HSF family TFs
Other *Cucumis sativus* TFs

1451 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
ENSAPLG00000011089	Anas platyrhynchos	ENSAPLG00000011089	N
Afo_R007602	Aptenodytes forsteri	Afo_R007602	N
Brh_R004406	Buceros rhinoceros	Brh_R004406	N
Aan_R006099	Calypte anna	Aan_R006099	N
ENSFALG00000004127	Ficedula albicollis	ENSFALG00000004127	N
ENSGALG00000016327	Gallus gallus	ENSGALG00000016327	N
Gfo_R003736	Geospiza fortis	Gfo_R003736	N
ENSPSIG00000016052	Pelodiscus sinensis	ENSPSIG00000016052	N
ENSTGUG00000007219	Taeniopygia guttata	ENSTGUG00000007219	N
Tal_R003082	Tyto alba	Tal_R003082	N

Cucsa.016480 (Cucumis sativus) HSF

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

1451 Related TFs

Cucsa.016480 **(Cucumis sativus)
HSF**