CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Lus10000492.g *(Linum usitatissimum)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	Lus10000492.g	T243208_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFA6B M06941_2.00	Arabidopsis thaliana	RGAASNTTCTAGA	TCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA6B_colamp_a	0.475	0.782
HSFA6B M06942_2.00	Arabidopsis thaliana	RGAABNTTCTRGAAN	NTTCYAGAANVTTCY	Dap-seq OMalley et al.(2016) HSFA6B_col	0.475	0.782
HSFA6A M06950_2.00	Arabidopsis thaliana	GAASNTTCTAGAANNW	WNNTTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_col_a	0.454	0.701
HSFA6A M06951_2.00	Arabidopsis thaliana	GAASNTTCTAGAA	TTCTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFA6A_colamp_a	0.454	0.701
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.450	0.713
HSFA1B M06948_2.00	Arabidopsis thaliana	GAANNTTCTAGA	TCTAGAANNTTC	Dap-seq OMalley et al.(2016) HSF3_col_a	0.431	0.747
HSFA1B M06949_2.00	Arabidopsis thaliana	TTCYRG	CYRGAA	Dap-seq OMalley et al.(2016) HSF3_colamp_a	0.431	0.747
HSFB4 M06936_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFB4_col_a	0.406	0.701
HSFA1E M06939_2.00	Arabidopsis thaliana	RGAANNTTCTAGA	TCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSFA1E_col_a	0.400	0.701
HSFA1E M06940_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFA1E_colamp_a	0.400	0.701
HSFB2B M06945_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_col_a	0.393	0.621
HSFB2B M06946_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_colamp_a	0.393	0.621
HSFB2A M00869_2.00	Arabidopsis thaliana	NNNNNTTCB	VGAANNNNN	PBM Franco-Zorrilla et al.(2014) HSFB2A	0.386	0.632
HSFB2A M06952_2.00	Arabidopsis thaliana	GAANNTTCYAGA	TCTRGAANNTTC	Dap-seq OMalley et al.(2016) HSF6_col_a	0.386	0.632
HSFC1 M00868_2.00	Arabidopsis thaliana	NDTCBNNN	NNNVGAHN	PBM Franco-Zorrilla et al.(2014) HSFC1	0.382	0.644
HSFC1 M06943_2.00	Arabidopsis thaliana	GAASNTTCTAG	CTAGAANSTTC	Dap-seq OMalley et al.(2016) HSFC1_col_a	0.382	0.644
HSFC1 M06944_2.00	Arabidopsis thaliana	RGAASNTTCTAGAANVW	WBNTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFC1_colamp_a	0.382	0.644
HSFB3 M06937_2.00	Arabidopsis thaliana	RRAANMWTCTAGAAV	BTTCTAGAWKNTTYY	Dap-seq OMalley et al.(2016) HSFB3_col_a	0.359	0.609
HSFB3 M06938_2.00	Arabidopsis thaliana	AABSTTCTAGAAN	NTTCTAGAASVTT	Dap-seq OMalley et al.(2016) HSFB3_colamp_a	0.359	0.609
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Lus10000492	HSF	43	133	FLTKTFEMVDDLFTNHVVSWSRGGTSFVVWDPHSFSTNLLPRFFKHNNFSSFVRQLNTYGFRKIDPERWEFANEEFLRGHKYLLKNIRRRK

Links
Other HSF family TFs
Other *Linum usitatissimum* TFs

1425 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
AB02577.1	Alternaria brassicicola	AB02577.1	N
COCC4DRAFT_66752	Bipolaris maydis	COCC4DRAFT_66752	N
COCMIDRAFT_6715	Bipolaris oryzae	COCMIDRAFT_6715	N
COCVIDRAFT_16525	Bipolaris victoriae	COCVIDRAFT_16525	N
COCCADRAFT_22640	Bipolaris zeicola	COCCADRAFT_22640	N
LEMA_P060670.1	Leptosphaeria maculans	LEMA_P060670.1	N
SETTUDRAFT_22399	Setosphaeria turcica	SETTUDRAFT_22399	N

Lus10000492.g (Linum usitatissimum) HSF

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

1425 Related TFs

Lus10000492.g **(Linum usitatissimum)
HSF**