CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GI19291 *(Drosophila mojavensis)* MADF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF10545 (MADF_DNA_bdg)	IPR006578	FBgn0142030	T248723_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Adf1 M03912_2.00	Drosophila melanogaster	GCAGCGCWGY	RCWGCGCTGC	SELEX Nitta et al.(2015) Adf1_1	0.968	0.973
Adf1 M06389_2.00	Drosophila melanogaster	CGRCYGCR	YGCRGYCG	B1H Zhu et al.(2011) Adf1_FlyReg_FBgn0000054	0.968	0.973
Adf1 M06390_2.00	Drosophila melanogaster	YMVMRGCAGAGMHVM	KBDKCTCTGCYKBKR	B1H Zhu et al.(2011) Adf1_SANGER_5_FBgn0000054	0.968	0.973
Adf1 M10898_2.00	Drosophila melanogaster	Transfac license required	Transfac license required	Transfac Matys et al.(2006) I$ADF1_Q6_01	0.968	0.973
Adf1 M10899_2.00	Drosophila melanogaster	BMGCBGYYGYNGCVBV	BVBGCNRCRRCVGCKV	Transfac Matys et al.(2006) I$ADF1_Q6	0.968	0.973
For this family, TFs with SR scores > 0.812* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
FBpp0168508	MADF	16	90	LIEAVKMNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVSEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFL

Links
Other MADF family TFs
Other *Drosophila mojavensis* TFs