CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Solyc06g059970.2 *(Solanum lycopersicum)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	Solyc06g059970.2	T256355_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MADS2_PETHY M10998_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS2_01	0.896	0.896
Q9AVU7_MALDO M11027_2.00	Malus domestica	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PI_01	0.875	0.875
FBP1_PETHY M10996_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP1_01	0.833	0.833
PI M08148_2.00	Arabidopsis thaliana	MCMAAARWRGAAAR	YTTTCYWYTTTKGK	ChIP-seq Mathelier et al.(2014) MA0559.1	0.792	0.792
AP3 M08146_2.00	Arabidopsis thaliana	WDCCMAAARWRGHAA	TTDCYWYTTTKGGHW	ChIP-seq Mathelier et al.(2014) MA0556.1	0.729	0.729
Q8VWZ4_MALDO M11026_2.00	Malus domestica	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS13_01	0.729	0.729
AP3 M10919_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADSB_Q2	0.729	0.729
Q40513_TOBAC M11001_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DEF_01	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Solyc06g059970.2.1	MADS box	10	57	RIENTNNRQVTYSKRRNGIIKKAKEITVLCEAKVSLIIFASSGKMHEY

Links
Other MADS box family TFs
Other *Solanum lycopersicum* TFs

122 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
PV07_05385	Cladophialophora immunda	PV07_05385	N