CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

MDP0000184294 *(Malus domestica)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00319 (SRF-TF)	IPR002100	MDP0000184294	T258672_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q8VWZ4_MALDO M11026_2.00	Malus domestica	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS13_01	1.000	1.000
AP3 M08146_2.00	Arabidopsis thaliana	WDCCMAAARWRGHAA	TTDCYWYTTTKGGHW	ChIP-seq Mathelier et al.(2014) MA0556.1	0.812	0.812
Q40513_TOBAC M11001_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DEF_01	0.812	0.812
AP3 M10919_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADSB_Q2	0.812	0.812
MADS2_PETHY M10998_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS2_01	0.771	0.771
Q9AVU7_MALDO M11027_2.00	Malus domestica	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PI_01	0.750	0.750
MADS16 M10971_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS16_01	0.729	0.729
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
MDP0000184294	MADS box	10	57	LIENQTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMLSNTNKMHEY

Links
Other MADS box family TFs
Other *Malus domestica* TFs

121 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action