CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

KLTH0E13156g *(Kluyveromyces thermotolerans)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00319 (SRF-TF)	IPR002100	KLTH0E13156g	T259365_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SMP1 M01557_2.00	Saccharomyces cerevisiae	TTAATAAA	TTTATTAA	PBM Zhu et al.(2009) Smp1	0.854	0.854
SMP1 M08587_2.00	Saccharomyces cerevisiae	BNDBMYWYAATTRWRNNWVNN	NNBWNNYWYAATTRWRKVHNV	Misc DeBoer et al.(2011) YBR182C_864	0.854	0.854
RLM1 M08590_2.00	Saccharomyces cerevisiae	NTAWWWWTAG	CTAWWWWTAN	Misc DeBoer et al.(2011) YPL089C_419	0.833	0.833
RLM1 M08459_2.00	Saccharomyces cerevisiae	NDWTCTAWWWATAGMYHN	NDRKCTATWWWTAGAWHN	COMPILED Mathelier et al.(2014) MA0369.1	0.833	0.833
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KLTH0E13156g	MADS box	10	57	PILDERNRTVTFIKRKAGLFKKAHELAVLCQADVAVIILGANNTFYEF

Links
Other MADS box family TFs
Other *Kluyveromyces thermotolerans* TFs