CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bostr.10064s0009 *(Boechera stricta)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Bostr.10064s0009	T285671_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RVE5 M01079_2.00	Arabidopsis thaliana	NWAATATCHN	NDGATATTWN	PBM Sullivan et al.(2014) pTH7138	0.875	0.978
RVE5 M07100_2.00	Arabidopsis thaliana	NNAAAATATCT	AGATATTTTNN	Dap-seq OMalley et al.(2016) At4g01280_col_a	0.875	0.978
RVE5 M07101_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) At4g01280_colamp_a	0.875	0.978
PK02532.1 M02347_2.00	Cannabis sativa	WAATATCTN	NAGATATTW	PBM Weirauch et al.(2014) pTH9579	0.837	0.913
RVE8 M01074_2.00	Arabidopsis thaliana	NNNRWATCNN	NNGATWYNNN	PBM Sullivan et al.(2014) pTH7136	0.829	0.891
RVE8 M07069_2.00	Arabidopsis thaliana	NHNWAAATATCT	AGATATTTWNDN	Dap-seq OMalley et al.(2016) At3g09600_col_a	0.829	0.891
RVE8 M07070_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) At3g09600_colamp_a	0.829	0.891
RVE4 M07117_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) LCL1_colamp_a	0.829	0.891
RVE4 M07118_2.00	Arabidopsis thaliana	NAAAATATCT	AGATATTTTN	Dap-seq OMalley et al.(2016) LCL1_col	0.829	0.891
RVE6 M01081_2.00	Arabidopsis thaliana	AATATCTD	HAGATATT	PBM Sullivan et al.(2014) pTH7151	0.827	0.891
RVE6 M07138_2.00	Arabidopsis thaliana	NNAAAATATCT	AGATATTTTNN	Dap-seq OMalley et al.(2016) At5g52660_col_a	0.827	0.891
RVE6 M07139_2.00	Arabidopsis thaliana	NNNWAAATATCT	AGATATTTWNNN	Dap-seq OMalley et al.(2016) At5g52660_colamp_a	0.827	0.891
mybG M02319_2.00	Dictyostelium discoideum	WAATATCT	AGATATTW	PBM Weirauch et al.(2014) pTH5362	0.808	0.870
PK08316.1 M02350_2.00	Cannabis sativa	NNNRWATCNN	NNGATWYNNN	PBM Weirauch et al.(2014) pTH9488	0.747	0.717
RVE1 M00879_2.00	Arabidopsis thaliana	AAATATCT	AGATATTT	PBM Franco-Zorrilla et al.(2014) RVE1	0.711	0.674
RVE1 M07128_2.00	Arabidopsis thaliana	NNNWAAATATCTNN	NNAGATATTTWNNN	Dap-seq OMalley et al.(2016) RVE1_col_a	0.711	0.674
RVE1 M07129_2.00	Arabidopsis thaliana	NNWAATATCW	WGATATTWNN	Dap-seq OMalley et al.(2016) RVE1_colamp_a	0.711	0.674
OS08G0157600 M02330_2.00	Oryza sativa	DNRTATCHN	NDGATAYNH	PBM Weirauch et al.(2014) pTH7793	0.691	0.674
LHY M06997_2.00	Arabidopsis thaliana	NWAAATATCT	AGATATTTWN	Dap-seq OMalley et al.(2016) LHY1_col_a	0.681	0.652
LHY M06998_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) LHY1_colamp_a	0.681	0.652
RVE7 M01069_2.00	Arabidopsis thaliana	NDHRWATCNN	NNGATWYDHN	PBM Sullivan et al.(2014) pTH7081	0.668	0.609
RVE7 M02286_2.00	Arabidopsis thaliana	NDARTATCH	DGATAYTHN	PBM Weirauch et al.(2014) pTH7277	0.668	0.609
RVE7L M07071_2.00	Arabidopsis thaliana	NNNNWAAATATCWNN	NNWGATATTTWNNNN	Dap-seq OMalley et al.(2016) AT3G10113_col_a	0.668	0.609
RVE7 M07008_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) EPR1_colamp_a	0.668	0.609
RVE7 M07009_2.00	Arabidopsis thaliana	NWAAATATCTHN	NDAGATATTTWN	Dap-seq OMalley et al.(2016) EPR1_col	0.668	0.609
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bostr.10064s0009.1.p	Myb	60	105	RENWTEQEHDKFLEALHLFDRDWKKIEAFVGSKTVVQIRSHAQKYF

Links
Other Myb/SANT family TFs
Other *Boechera stricta* TFs

430 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
MLOC_15181	Hordeum vulgare	MLOC_15181	N	0.000
MLOC_43730	Hordeum vulgare	MLOC_43730	N	0.000
Pavir.J35282	Panicum virgatum	Pavir.J35282	N	0.000
Traes_4AL_F023A8691	Triticum aestivum	Traes_4AL_F023A8691	N	0.000
Traes_4DS_050789E2A	Triticum aestivum	Traes_4DS_050789E2A	N	0.000
Traes_4DS_2B4E99BE4	Triticum aestivum	Traes_4DS_2B4E99BE4	N	0.000
Traes_4DS_82065CB2C	Triticum aestivum	Traes_4DS_82065CB2C	N	0.000
TRIUR3_05949	Triticum urartu	TRIUR3_05949	N	0.000

Bostr.10064s0009 (Boechera stricta) Myb/SANT

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

430 Related TFs

Bostr.10064s0009 **(Boechera stricta)
Myb/SANT**