CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Thhalv10008620m.g *(Eutrema salsugineum)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Thhalv10008620m.g	T290005_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT1G14600 M01268_2.00	Arabidopsis thaliana	NWAYATTCYN	NRGAATRTWN	PBM Lambert et al.(2019) pTH11557	0.894	0.979
PHR1 M02329_2.00	Oryza sativa	NWKATNCBNN	NNVGNATMWN	PBM Weirauch et al.(2014) pTH7755	0.692	0.787
PHL6 M02295_2.00	Arabidopsis thaliana	NNWKATNCBN	NVGNATMWNN	PBM Weirauch et al.(2014) pTH7071	0.682	0.723
PHL6 M07083_2.00	Arabidopsis thaliana	NDGAAAACH	DGTTTTCHN	Dap-seq OMalley et al.(2016) At3g13040_col_b	0.682	0.723
KAN1 M00878_2.00	Arabidopsis thaliana	NNRTNBNN	NNVNAYNN	PBM Franco-Zorrilla et al.(2014) KAN1	0.667	0.723
KAN1 M02308_2.00	Arabidopsis thaliana	NDNDTAHNHN	NDNDTAHNHN	PBM Weirauch et al.(2014) pTH7135	0.667	0.723
KAN2 M07018_2.00	Arabidopsis thaliana	HHHNDWATATTCTYH	DRAGAATATWHNDDD	Dap-seq OMalley et al.(2016) KAN2_col_a	0.667	0.723
KAN2 M07019_2.00	Arabidopsis thaliana	NWWTATTCYYH	DRRGAATAWWN	Dap-seq OMalley et al.(2016) KAN2_colamp_a	0.667	0.723
PHR1 M02302_2.00	Arabidopsis thaliana	NWKATNCBNN	NNVGNATMWN	PBM Weirauch et al.(2014) pTH7249	0.661	0.766
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10008620m	Myb	26	77	RLRWTPELHRSFVHAVDLLGGEYKATPKLVLKIMDMKGLTISHVKSHLQMYR

Links
Other Myb/SANT family TFs
Other *Eutrema salsugineum* TFs

504 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
Pm024633	Prunus mume	Pm024633	N
PRUPE_ppa017571mg	Prunus persica	PRUPE_ppa017571mg	N
VIT_17s0000g05400	Vitis vinifera	VIT_17s0000g05400	I