CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSCPOG00000005739 *(Cavia porcellus)* Pipsqueak
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF05225 (HTH_psq)	IPR007889	ENSCPOG00000005739	T313529_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ENSMGAG00000009953 M02433_2.00	Meleagris gallopavo	NNNYNAAWNN	NNWTTNRNNN	PBM Weirauch et al.(2014) pTH8649	1.000	1.000
ENSACAG00000012432 M02430_2.00	Anolis carolinensis	NNNCNAAWNN	NNWTTNGNNN	PBM Weirauch et al.(2014) pTH9220	0.956	0.956
lcorl M02438_2.00	Xenopus tropicalis	NYCNAAWHN	NDWTTNGRN	PBM Weirauch et al.(2014) pTH8558	0.956	0.956
ENSORLG00000000044 M02434_2.00	Oryzias latipes	CCCAAAWT	AWTTTGGG	PBM Weirauch et al.(2014) pTH9275	0.911	0.911
ENSGACG00000007469 M02432_2.00	Gasterosteus aculeatus	NVNMGAWACH	DGTWTCKNBN	PBM Weirauch et al.(2014) pTH9179	0.822	0.822
ENSORLG00000007805 M02435_2.00	Oryzias latipes	SCNAAWNNNN	NNNNWTTNGS	PBM Weirauch et al.(2014) pTH9277	0.822	0.822
LCORL M02431_2.00	Choloepus hoffmanni	NNYNAAHNN	NNDTTNRNN	PBM Weirauch et al.(2014) pTH9253	0.800	0.800
For this family, TFs with SR scores > 0.778* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSCPOP00000005176	Pipsqueak	350	395	NSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKN

Links
Other Pipsqueak family TFs
Other *Cavia porcellus* TFs