CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

NFIA_103860 *(Neosartorya fischeri)* Sox
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00505 (HMG_box)	IPR000910	CADNFIAG00010220	T326789_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
fmf-1 M02491_2.00	Neurospora crassa	TCTTTGTY	RACAAAGA	PBM Weirauch et al.(2014) pTH8941	0.605	0.493
ste11 M11342_2.00	Schizosaccharomyces pombe	DWNTTTCTTTGTTHNHWW	WWDNDAACAAAGAAANWH	Transfac Matys et al.(2006) F$STE11_01	0.510	0.362
ste11 M11343_2.00	Schizosaccharomyces pombe	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$STE11_02	0.510	0.362
mat1-Mc M11340_2.00	Schizosaccharomyces pombe	NRMNNAACAAAGAVRYMW	AKRYBTCTTTGTTNNKYN	Transfac Matys et al.(2006) F$MAT1MC_01	0.494	0.348
mat1-Mc M11341_2.00	Schizosaccharomyces pombe	YYHATTGTYD	HRACAATDRR	Transfac Matys et al.(2006) F$MAT1MC_02	0.494	0.348
For this family, TFs with SR scores > 0.415* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CADNFIAP00009980	Sox	196	264	VARPMNSFMLYRSAYAERTKEWFAQNNHQVVSEVAGDSWRIETPEIREKYEVLANVEKTNHLKAHPGYK

Links
Other Sox family TFs
Other *Neosartorya fischeri* TFs