CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ORUFI04G25800 *(Oryza rufipogon)* WRC
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF08879 (WRC)	IPR014977	ORUFI04G25800	T351141_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AtGRF6 M02545_2.00	Arabidopsis thaliana	NNNNYDNN	NNHRNNNN	PBM Weirauch et al.(2014) pTH7356	0.814	0.814
AtGRF6 M07369_2.00	Arabidopsis thaliana	NNNNNHNTGTCAGA	TCTGACANDNNNNN	Dap-seq OMalley et al.(2016) AtGRF6_col_a	0.814	0.814
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ORUFI04G25800.1	WRC	115	157	PEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVE

Links
Other WRC family TFs
Other *Oryza rufipogon* TFs