CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bo9g064170 *(Brassica oleracea)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	Bo9g064170	T352217_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY8 M02564_2.00	Arabidopsis thaliana	NRGTCAAHN	NDTTGACYN	PBM Weirauch et al.(2014) pTH7554	0.810	0.905
WRKY8 M07428_2.00	Arabidopsis thaliana	NAAAAGTCAACRNHW	WDNYGTTGACTTTTN	Dap-seq OMalley et al.(2016) WRKY8_colamp_a	0.810	0.905
WRKY8 M07429_2.00	Arabidopsis thaliana	NNVAAAGTCAACRNH	DNYGTTGACTTTBNN	Dap-seq OMalley et al.(2016) WRKY8_col	0.810	0.905
WRKY28 M07406_2.00	Arabidopsis thaliana	HAAAGTCAAMNNH	DNNKTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY28_col_a	0.810	0.857
WRKY28 M07407_2.00	Arabidopsis thaliana	VAAAGTCAAMG	CKTTGACTTTB	Dap-seq OMalley et al.(2016) WRKY28_colamp_a	0.810	0.857
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bo9g064170.1	WRKY	2	43	SYENRSYYRCTTQKCNVKKRVERSYQDPTVVITTYESQHDHP

Links
Other WRKY family TFs
Other *Brassica oleracea* TFs