CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

OGLUM11G00880 *(Oryza glumaepatula)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	OGLUM11G00880	T353609_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY29 M02558_2.00	Arabidopsis thaliana	NNNGTCHDNN	NNHDGACNNN	PBM Weirauch et al.(2014) pTH9604	0.816	0.517
WRKY29 M07410_2.00	Arabidopsis thaliana	HAAAGTCAACK	MGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY29_col_a	0.816	0.517
WRKY29 M07411_2.00	Arabidopsis thaliana	HWWAGTCAAMDNN	NNHKTTGACTWWD	Dap-seq OMalley et al.(2016) WRKY29_colamp_a	0.816	0.517
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OGLUM11G00880.1	WRKY	130	191	FDGYQWRKYGQKQIEGAMYPRSYYRCTNSTNQGCLAKKTVQRNGGGGAAGYTVAYISEHTCK

Links
Other WRKY family TFs
Other *Oryza glumaepatula* TFs