CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

15411_YLL054C *(Saccharomyces bayanus)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00172 (Zn_clus)	IPR001138	15411_YLL054C	T390771_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
YLL054C M00094_2.00	Saccharomyces cerevisiae	NNCGGVN	NBCCGNN	PBM Badis et al.(2008) YLL054C_2046	0.649	0.897
YLL054C M01587_2.00	Saccharomyces cerevisiae	NNCGGVNNN	NNNBCCGNN	PBM Zhu et al.(2009) Yll054c	0.649	0.897
YLL054C M07520_2.00	Saccharomyces cerevisiae	CGGMSGH	DCSKCCG	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0429.1	0.649	0.897
YLL054C M08675_2.00	Saccharomyces cerevisiae	CGGMCGH	DCGKCCG	Misc DeBoer et al.(2011) YLL054C_526	0.649	0.897
YLL054C M08676_2.00	Saccharomyces cerevisiae	TCCGNNNNNNNNNNCGGA	TCCGNNNNNNNNNNCGGA	Misc DeBoer et al.(2011) YLL054C_816	0.649	0.897
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
15411_YLL054C	Zinc cluster	13	51	FVCLRCKQRKIKCDKLWPTCSKCKASSSACTYEIEPGRT

Links
Other Zinc cluster family TFs
Other *Saccharomyces bayanus* TFs