CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

BGIOSGA000613 *(Oryza indica)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	BGIOSGA000613	T057094_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DPBF3 M01133_2.00	Arabidopsis thaliana	HBACGTGKMN	NKMCACGTVD	PBM Lambert et al.(2019) pTH11531	0.812	0.812
DPBF3 M01058_2.00	Arabidopsis thaliana	HBACGTGKM	KMCACGTVD	PBM Sullivan et al.(2014) pTH7219	0.812	0.812
DPBF3 M01059_2.00	Arabidopsis thaliana	NNMCACGTVN	NBACGTGKNN	PBM Sullivan et al.(2014) pTH7547	0.812	0.812
DPBF3 M06777_2.00	Arabidopsis thaliana	TGMCACGTSWYMHHH	DDDKRWSACGTGKCA	Dap-seq OMalley et al.(2016) AREB3_colamp_a	0.812	0.812
DPBF3 M06778_2.00	Arabidopsis thaliana	TGMCACGTSWYMHHH	DDDKRWSACGTGKCA	Dap-seq OMalley et al.(2016) AREB3_col_v31	0.812	0.812
PK24978.1 M01162_2.00	Cannabis sativa	NNNCACGTRTHNNNN	NNNNDAYACGTGNNN	PBM Lambert et al.(2019) pTH10153	0.787	0.729
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
BGIOSGA000613-PA	bZIP	271	318	MERRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENVRLKRQKV

Links
Other bZIP family TFs
Other *Oryza indica* TFs