CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GLYMA06G09100 *(Glycine max)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	GLYMA06G09100	T218770_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ATHB-9 M06898_2.00	Arabidopsis thaliana	DWWDRTAATGATKAH	DTMATCATTAYHWWH	Dap-seq OMalley et al.(2016) PHV_col_a	0.866	0.946
ATHB-9 M02682_2.00	Arabidopsis thaliana	HNHHGTAATGATTRCDYBS	SVRHGYAATCATTACDDND	SELEX Mathelier et al.(2014) MA0573.1	0.866	0.946
ATHB-9 M10623_2.00	Arabidopsis thaliana	HNHHGTAATGATTRCDYBS	SVRHGYAATCATTACDDND	Transfac Matys et al.(2006) P$ATHB9_01	0.866	0.946
ATHB-15 M00864_2.00	Arabidopsis thaliana	AATAATTACT	AGTAATTATT	PBM Franco-Zorrilla et al.(2014) ICU4	0.862	0.964
ATHB-15 M06899_2.00	Arabidopsis thaliana	DWWDRTAATGATKAH	DTMATCATTAYHWWH	Dap-seq OMalley et al.(2016) ATHB15_col_a	0.862	0.964
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA06G09100.1	Homeodomain	19	78	GKYVRYTPEQVEALERLYHECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQ

Links
Other Homeodomain family TFs
Other *Glycine max* TFs