CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GLYMA13G09660 *(Glycine max)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	GLYMA13G09660	T254200_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MADS2_PETHY M10998_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS2_01	0.875	0.875
FBP1_PETHY M10996_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP1_01	0.854	0.854
Q9AVU7_MALDO M11027_2.00	Malus domestica	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PI_01	0.833	0.833
PI M08148_2.00	Arabidopsis thaliana	MCMAAARWRGAAAR	YTTTCYWYTTTKGK	ChIP-seq Mathelier et al.(2014) MA0559.1	0.750	0.750
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA13G09660.1	MADS box	10	57	RIENSSNRQVTYSKRKNGILKKAKEITVLCDAQVSLIIFAASGKMHDY

Links
Other MADS box family TFs
Other *Glycine max* TFs

80 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action