CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GSMUA_Achr5G26530_001 *(Musa acuminata)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	GSMUA_Achr5G26530_001	T254392_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AP1 M08144_2.00	Arabidopsis thaliana	MYAAAAAWRGAAA	TTTCYWTTTTTRK	ChIP-seq Mathelier et al.(2014) MA0940.1	0.708	0.708
MADS50 M10968_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS50_01	0.708	0.708
AP1 M10905_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADSA_Q2	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr5P26530_001	MADS box	20	67	RIENEEARQVCFSKRRAGLFKKATELSVLCGAEIALVVFSPAGKPFSF

Links
Other MADS box family TFs
Other *Musa acuminata* TFs

204 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action