CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SINV13405 *(Solenopsis invicta)* Runt
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00853 (Runt)	IPR013524	SINV13405	T319622_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
lz M03964_2.00	Drosophila melanogaster	HRACCGCAAHM	KDTTGCGGTYD	SELEX Nitta et al.(2015) lz_1	0.833	0.833
lz M03965_2.00	Drosophila melanogaster	HVACCRCARWAACCRCAV	BTGYGGTTWYTGYGGTBD	SELEX Nitta et al.(2015) lz_2	0.833	0.833
lz M03966_2.00	Drosophila melanogaster	WRACCRCAWTAACCRCAA	TTGYGGTTAWTGYGGTYW	SELEX Nitta et al.(2015) lz_3	0.833	0.833
lz M03967_2.00	Drosophila melanogaster	HRACCGCAAAACCRCAR	YTGYGGTTTTGCGGTYD	SELEX Nitta et al.(2015) lz_4	0.833	0.833
run M06444_2.00	Drosophila melanogaster	WAACCGCAR	YTGCGGTTW	B1H Zhu et al.(2011) run_Bgb_NBT_FBgn0003300	0.700	0.700
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
SINV13405-PA	Runt	1	30	MLQTSPPQVATLSKAIKVTVDGPREPRSKT

Links
Other Runt family TFs
Other *Solenopsis invicta* TFs