CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

4533_YDR213W *(Saccharomyces paradoxus)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00172 (Zn_clus)	IPR001138	4533_YDR213W	T390854_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
UPC2 M00920_2.00	Saccharomyces cerevisiae	NTCGTWYVN	NBRWACGAN	PBM Gordan et al.(2011) Upc2	0.683	0.974
UPC2 M07508_2.00	Saccharomyces cerevisiae	NRWACGA	TCGTWYN	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0411.1	0.683	0.974
UPC2 M08654_2.00	Saccharomyces cerevisiae	NRWACGA	TCGTWYN	Misc DeBoer et al.(2011) YDR213W_544	0.683	0.974
ECM22 M00096_2.00	Saccharomyces cerevisiae	NNCSGRDNHN	NDNHYCSGNN	PBM Badis et al.(2008) ECM22_2066	0.541	0.692
ECM22 M00924_2.00	Saccharomyces cerevisiae	NNDWACGRN	NYCGTWHNN	PBM Gordan et al.(2011) Ecm22	0.541	0.692
ECM22 M01589_2.00	Saccharomyces cerevisiae	NNNCGGVN	NBCCGNNN	PBM Zhu et al.(2009) Ecm22	0.541	0.692
ECM22 M07522_2.00	Saccharomyces cerevisiae	TCCGGAD	HTCCGGA	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0292.1	0.541	0.692
ECM22 M08679_2.00	Saccharomyces cerevisiae	NNYCGGRNNDMCGGAVNH	DNBTCCGKHNNYCCGRNN	Misc DeBoer et al.(2011) YLR228C_849	0.541	0.692
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
4533_YDR213W	Zinc cluster	49	88	NGCDNCKRRRVKCDEGKPACRKCTNMKLECLYTPIHLRKG

Links
Other Zinc cluster family TFs
Other *Saccharomyces paradoxus* TFs