CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

AMTR_s00021p00223240 *(Amborella trichopoda)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	AMTR_s00021p00223240	T000354_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF023 M06560_2.00	Arabidopsis thaliana	DYCACCGACANHDNN	NNHDNTGTCGGTGRH	Dap-seq OMalley et al.(2016) AT1G01250_col_a	0.749	0.880
ERF023 M06561_2.00	Arabidopsis thaliana	HHNHHDHCACCGACA	TGTCGGTGDHDDNDD	Dap-seq OMalley et al.(2016) AT1G01250_colamp_a	0.749	0.880
ERF021 M06593_2.00	Arabidopsis thaliana	HNYCDYCDYCDYCRCCGHCD	HGDCGGYGRHGRHGRHGRND	Dap-seq OMalley et al.(2016) AT1G71450_col_a	0.677	0.740
ERF021 M06594_2.00	Arabidopsis thaliana	NHNNCRCCGHCDH	DHGDCGGYGNNDN	Dap-seq OMalley et al.(2016) AT1G71450_colamp_a	0.677	0.740
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ERN14075	AP2	56	107	PVFRGVRKRRWGKWVSEIREPRKKSRIWLGSFPTAEMAAHAYDVAALNLKGR

Links
Other AP2 family TFs
Other *Amborella trichopoda* TFs