CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Cagra.0096s0029 *(Capsella grandiflora)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Cagra.0096s0029	T007682_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RAP2-4 M01612_2.00	Arabidopsis thaliana	NRCCGHCMNN	NNKGDCGGYN	PBM Weirauch et al.(2014) pTH8092	0.867	1.000
ERF055 M06577_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_col_a	0.848	0.960
ERF055 M06578_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_colamp_a	0.848	0.960
AT5G65130 M06686_2.00	Arabidopsis thaliana	YCDYCDCCRCCGCCN	NGGCGGYGGHGRHGR	Dap-seq OMalley et al.(2016) At5g65130_col_a	0.721	0.860
AT5G65130 M06687_2.00	Arabidopsis thaliana	NNNNHNNHDSCRCCGMCMW	WKGKCGGYGSHDNNDNNNN	Dap-seq OMalley et al.(2016) At5g65130_colamp_a	0.721	0.860
ERF054 M06647_2.00	Arabidopsis thaliana	NNNNNNNNNHHDSCRCCGHC	GDCGGYGSHDDNNNNNNNNN	Dap-seq OMalley et al.(2016) At4g28140_col_a	0.684	0.820
ERF054 M06648_2.00	Arabidopsis thaliana	NNNNHDBCRCCGHCM	KGDCGGYGVHDNNNN	Dap-seq OMalley et al.(2016) At4g28140_colamp_a	0.684	0.820
WIN1 M01603_2.00	Arabidopsis thaliana	VCRCCGCNNN	NNNGCGGYGB	PBM Weirauch et al.(2014) pTH7566	0.683	0.660
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cagra.0096s0029.1.p	AP2	158	209	KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGD

Links
Other AP2 family TFs
Other *Capsella grandiflora* TFs

457 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
ACLA_081150	Aspergillus clavatus	CADACLAG00008209	N
CADAFLAG00005898	Aspergillus flavus	CADAFLAG00005898	N
AFUA_2G09330	Aspergillus fumigatus	CADAFUAG00004369	N
CADANGAG00009940	Aspergillus niger	CADANGAG00009940	N
NFIA_084840	Neosartorya fischeri	CADNFIAG00008265	N
EURHEDRAFT_452238	Aspergillus ruber	EURHEDRAFT_452238	N
PCH_Pc16g11120	Penicillium rubens	PCH_Pc16g11120	N
PDIP_19380	Penicillium digitatum	PDIP_19380	N
PEX1_057680	Penicillium expansum	PEX1_057680	N
U727_00431181291	Penicillium solitum	U727_00431181291	N
fgenesh1_pg.00772_#_141	Aspergillus carbonarius	fgenesh1_pg.00772_#_141	N
Pc16g11120	Penicillium chrysogenum	Pc16g11120	N