CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Gorai.007G359400 *(Gossypium raimondii)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Gorai.007G359400	T008602_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK08602.1 M01098_2.00	Cannabis sativa	NYCACCGCYN	NRGCGGTGRN	PBM Lambert et al.(2019) pTH11421	0.799	0.940
DREB2F M06630_2.00	Arabidopsis thaliana	YCDCCRCCGCY	RGCGGYGGHGR	Dap-seq OMalley et al.(2016) AT3G57600_col_a	0.768	0.900
Q8H769_WHEAT M09721_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1_01	0.683	0.780
DREB2G M06662_2.00	Arabidopsis thaliana	DCCRCCGCYDYHDYH	DRHDRHRGCGGYGGH	Dap-seq OMalley et al.(2016) At5g18450_col_a	0.679	0.760
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Gorai.007G359400.1	AP2	28	79	CQYRGVRQRTWGKWVAEIREPKKRTRLWLGSFATAEEAAMAYDDAARRLYGP

Links
Other AP2 family TFs
Other *Gossypium raimondii* TFs