CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSAMEG00000002709 *(Ailuropoda melanoleuca)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	ENSAMEG00000002709	T032770_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Hes7 M01727_2.00	Mus musculus	NVCACGHGNN	NNCDCGTGBN	PBM Weirauch et al.(2014) pTH5260	0.890	0.981
HES7 M02802_2.00	Homo sapiens	YGGCACGTGCCR	YGGCACGTGCCR	SELEX Jolma et al.(2013) HES7_1	0.890	0.981
HES7 M04191_2.00	Homo sapiens	NVCRCGTGSC	GSCACGYGBN	SELEX Yin et al.(2017) HES7_eDBD_HT-SELEX	0.890	0.981
Hes7 M09887_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$HES7_02	0.890	0.981
HES7 M04192_2.00	Homo sapiens	NVCRCRTGVV	BBCAYGYGBN	SELEX Yin et al.(2017) HES7_eDBD_Methyl-HT-SELEX	0.890	0.981
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSAMEP00000002836	bHLH	14	70	KMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERS

Links
Other bHLH family TFs
Other *Ailuropoda melanoleuca* TFs