CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ALUE_0000745301 *(Ascaris lumbricoides)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	ALUE_0000745301	T053389_2.00	WormBase:ParaSite (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
hlh-1 M00746_2.00	Caenorhabditis elegans	RACAGCTGNN	NNCAGCTGTY	PBM DeMasi et al.(2011) HLH-1	0.914	0.942
hlh-1 M00929_2.00	Caenorhabditis elegans	GACAGCTG	CAGCTGTC	PBM Grove et al.(2009) HLH1	0.914	0.942
hlh-1 M08063_2.00	Caenorhabditis elegans	VAACAGYTGNY	RNCARCTGTTB	ChIP-seq Mathelier et al.(2014) MA0545.1	0.914	0.942
hlh-1 M09481_2.00	Caenorhabditis elegans	NNRNCARNTGNY	RNCANYTGNYNN	Misc Heinz et al.(2010) cElegans-Embryo-HLH1_modEncode	0.914	0.942
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ALUE_0000745301-mRNA-1	bHLH	165	216	RRKAATMRERRRLRKVNEAFEVVKQRTCPNPNQRLPKVEILRSAIEYITKLE

Links
Other bHLH family TFs
Other *Ascaris lumbricoides* TFs