CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GRMZM2G149040 *(Zea mays)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	GRMZM2G149040	T063152_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BZIP18 M01777_2.00	Arabidopsis thaliana	NDMCARNHNN	NNDNYTGKHN	PBM Weirauch et al.(2014) pTH7316	0.787	0.963
BZIP18 M06768_2.00	Arabidopsis thaliana	DTGMCAGCTDD	HHAGCTGKCAH	Dap-seq OMalley et al.(2016) bZIP18_colamp_a	0.787	0.963
BZIP18 M06769_2.00	Arabidopsis thaliana	TGMCAGCTKKN	NMMAGCTGKCA	Dap-seq OMalley et al.(2016) bZIP18_col_v31	0.787	0.963
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GRMZM2G149040_P01	bZIP	167	220	DPKRAKRIIANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDT

Links
Other bZIP family TFs
Other *Zea mays* TFs