CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Q39895_SOYBN *(Glycine max)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	Q39895_SOYBN	T067509_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q39895_SOYBN M10048_2.00	Glycine max	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$STF1_01	(Direct)	(Direct)
Q39895_SOYBN M10049_2.00	Glycine max	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$STF1_02	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HY5 M06790_2.00	Arabidopsis thaliana	DNHGVTGACGTSDMN	NKHSACGTCABCDNH	Dap-seq OMalley et al.(2016) HY5_colamp_v3a	0.857	0.875
HY5 M08407_2.00	Arabidopsis thaliana	NNHGMCACGTGKCDNN	NNHGMCACGTGKCDNN	ChIP-chip Mathelier et al.(2014) MA0551.1	0.857	0.875
HY5 M09919_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$HY5_01	0.857	0.875
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Q39895_SOYBN	bZIP	246	309	DKESKRLKRLLRNRVSAQQARERKKAYLIDLETRVKDLEKKNSELKERLSTLQNENQMLRQILK

Links
Other bZIP family TFs
Other *Glycine max* TFs