CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Cagra.1642s0027 *(Capsella grandiflora)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	Cagra.1642s0027	T071492_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BZIP18 M01777_2.00	Arabidopsis thaliana	NDMCARNHNN	NNDNYTGKHN	PBM Weirauch et al.(2014) pTH7316	0.846	1.000
BZIP18 M06768_2.00	Arabidopsis thaliana	DTGMCAGCTDD	HHAGCTGKCAH	Dap-seq OMalley et al.(2016) bZIP18_colamp_a	0.846	1.000
BZIP18 M06769_2.00	Arabidopsis thaliana	TGMCAGCTKKN	NMMAGCTGKCA	Dap-seq OMalley et al.(2016) bZIP18_col_v31	0.846	1.000
PK00315.1 M01153_2.00	Cannabis sativa	NNGACAGCTRN	NYAGCTGTCNN	PBM Lambert et al.(2019) pTH10085	0.831	0.935
PK16335.1 M01157_2.00	Cannabis sativa	NNNNKACAGCTRN	NYAGCTGTMNNNN	PBM Lambert et al.(2019) pTH10187	0.831	0.935
AtbZIP52 M06746_2.00	Arabidopsis thaliana	DTGMCAGCYBDNHH	DDNHVRGCTGKCAH	Dap-seq OMalley et al.(2016) bZIP52_colamp_a	0.817	0.871
AtbZIP52 M06747_2.00	Arabidopsis thaliana	DTGMCAGCYKDNHN	NDNHMRGCTGKCAH	Dap-seq OMalley et al.(2016) bZIP52_col_v31	0.817	0.871
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cagra.1642s0027.1.p	bZIP	148	209	DPKRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSENT

Links
Other bZIP family TFs
Other *Capsella grandiflora* TFs