CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

KLTH0E02222g *(Kluyveromyces thermotolerans)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	KLTH0E02222g	T073391_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
CIN5 M00015_2.00	Saccharomyces cerevisiae	GMTTAYRTMA	TKAYRTAAKC	PBM Badis et al.(2008) CIN5_2059	0.810	0.603
CIN5 M00908_2.00	Saccharomyces cerevisiae	NTKACGTAANNN	NNNTTACGTMAN	PBM Gordan et al.(2011) Cin5	0.810	0.603
CIN5 M07445_2.00	Saccharomyces cerevisiae	TKAYVTAAKC	GMTTABRTMA	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0284.1	0.810	0.603
CIN5 M08506_2.00	Saccharomyces cerevisiae	KAATBAYV	BRTVATTM	Misc DeBoer et al.(2011) YOR028C_1349	0.810	0.603
CIN5 M08507_2.00	Saccharomyces cerevisiae	TTAYRTAA	TTAYRTAA	Misc DeBoer et al.(2011) YOR028C_409	0.810	0.603
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KLTH0E02222g	bZIP	176	241	GKPLRNTKRAAQNRNAQKAFRQRRERYIKDLEVKAKEYDRMDAQTAALVQENESLKRYVLELEQRL

Links
Other bZIP family TFs
Other *Kluyveromyces thermotolerans* TFs