CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSGALG00000025974 *(Gallus gallus)* STAT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02864 (STAT_bind)	IPR013801	ENSGALG00000025974	T337463_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Stat4 M08174_2.00	Mus musculus	NNNYTTCYYRGAAV	BTTCYRRGAARNNN	ChIP-seq Mathelier et al.(2014) MA0518.1	0.868	0.868
Stat4 M09424_2.00	Mus musculus	YTTCYHDKMA	TKMHDRGAAR	Misc Kulakovskiy et al.(2013) STAT4_MOUSE.H11MO.0.A	0.868	0.868
Stat4 M09646_2.00	Mus musculus	NYTTCCNGGAAR	YTTCCNGGAARN	Misc Heinz et al.(2010) CD4-Stat4_GSE22104	0.868	0.868
STAT4 M09413_2.00	Homo sapiens	YTTCYBDKMAN	NTKMHVRGAAR	Misc Kulakovskiy et al.(2013) STAT4_HUMAN.H11MO.0.A	0.863	0.863
STAT4 M11361_2.00	Homo sapiens	BNHTTCNN	NNGAADNV	Transfac Matys et al.(2006) V$STAT4_01	0.863	0.863
STAT4 M11362_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$STAT4_Q4	0.863	0.863
STAT4 M11363_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$STAT4_Q5	0.863	0.863
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSGALP00000038654	STAT	316	563	FVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQIRVKATIDKNVSTVSNRRFVLCGTHVKAMNMDESANGSLSVEFRHLQPKEMKSSAGSKGNEGPHMVTEELHSISFETQVCLYGLTINLETSSLPVVMISNVSQLPNAWASIIWYNLSTNDPQNLSFFNNPPAATLSQLLEVLSWQFSSYVGRGLNSEQLNMLAEKLMGQQVSYSDYQLSWAKFCKEHLPGKSFTFWVWLEAILDLIK

Links
Other STAT family TFs
Other *Gallus gallus* TFs