CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GSMUA_Achr6G05210_001 *(Musa acuminata)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	GSMUA_Achr6G05210_001	T002419_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WIN1 M01603_2.00	Arabidopsis thaliana	VCRCCGCNNN	NNNGCGGYGB	PBM Weirauch et al.(2014) pTH7566	0.841	0.980
ERF003 M06667_2.00	Arabidopsis thaliana	DYCDCCRCCGYMDHHDYHN	NDRHDDHKRCGGYGGHGRH	Dap-seq OMalley et al.(2016) ESE3_col_a	0.727	0.824
ERF003 M06668_2.00	Arabidopsis thaliana	HDYCKCCGCCGYHDH	DHDRCGGCGGMGRHD	Dap-seq OMalley et al.(2016) ESE3_colamp_a	0.727	0.824
RAP2-4 M01612_2.00	Arabidopsis thaliana	NRCCGHCMNN	NNKGDCGGYN	PBM Weirauch et al.(2014) pTH8092	0.683	0.647
ERF055 M06577_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_col_a	0.680	0.647
ERF055 M06578_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_colamp_a	0.680	0.647
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr6P05210_001	AP2	5	56	KKFRGVRQRHWGSWVAEIRHPLLKRRVWLGTFETAEEAARAYDEAAVLMSGR

Links
Other AP2 family TFs
Other *Musa acuminata* TFs