CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

OGLUM08G25470 *(Oryza glumaepatula)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	OGLUM08G25470	T003305_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q1ESI9_MAIZE M09714_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB2A_02	0.701	0.816
DREB2G M06662_2.00	Arabidopsis thaliana	DCCRCCGCYDYHDYH	DRHDRHRGCGGYGGH	Dap-seq OMalley et al.(2016) At5g18450_col_a	0.686	0.816
DREB2D M01611_2.00	Arabidopsis thaliana	NNRCCGHNN	NNDCGGYNN	PBM Weirauch et al.(2014) pTH8108	0.682	0.816
DREB2D M06597_2.00	Arabidopsis thaliana	YHNYYDCCRCCGYYD	HRRCGGYGGHRRNDR	Dap-seq OMalley et al.(2016) At1g75490_col_a	0.682	0.816
DREB2D M06598_2.00	Arabidopsis thaliana	HNNHDYCACCGHYWN	NWRDCGGTGRHDNND	Dap-seq OMalley et al.(2016) At1g75490_colamp_a	0.682	0.816
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OGLUM08G25470.1	AP2	54	105	CPFRGVRQRTWGKWVAEIREPNRGARLWLGTFNTALDAARAYDSAARALYGD

Links
Other AP2 family TFs
Other *Oryza glumaepatula* TFs