CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Gfo_R006237 *(Geospiza fortis)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	Gfo_R006237	T047326_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LYL1 M08714_2.00	Homo sapiens	VNRRNVVCAGMWGN	NCWKCTGBBNYYNB	Misc Kulakovskiy et al.(2013) LYL1_HUMAN.H11MO.0.A	0.892	0.808
TAL1 M08734_2.00	Homo sapiens	BSTTATCWSNNNNNNVCVV	BBGBNNNNNNSWGATAASV	Misc Kulakovskiy et al.(2013) TAL1_HUMAN.H11MO.0.A	0.870	0.865
Tal1 M08759_2.00	Mus musculus	BYKBNNNNNNVWGATAAVVN	NBBTTATCWBNNNNNNVMRV	Misc Kulakovskiy et al.(2013) TAL1_MOUSE.H11MO.0.A	0.870	0.865
Tal1 M09471_2.00	Mus musculus	NVCWKMWG	CWKMWGBN	Misc Heinz et al.(2010) HPC7-Scl_GSE13511	0.870	0.865
Tal1 M09472_2.00	Mus musculus	YTATCWSNNNNNNVCAGVHN	NDBCTGBNNNNNNSWGATAR	Misc Heinz et al.(2010) Ter119-SCL_GSE18720	0.870	0.865
TAL1 M09870_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$TAL1_01	0.870	0.865
TAL1 M09871_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$TAL1_Q6_01	0.870	0.865
TAL1 M09872_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$TAL1_Q6	0.870	0.865
Lyl1 M08763_2.00	Mus musculus	VNRRNVVCAGMWGN	NCWKCTGBBNYYNB	Misc Kulakovskiy et al.(2013) LYL1_MOUSE.H11MO.0.A	0.856	0.788
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Gfo_R006237	bHLH	3	55	RKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLV

Links
Other bHLH family TFs
Other *Geospiza fortis* TFs

184 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
M437DRAFT_41053	Aureobasidium melanogenum	M437DRAFT_41053	N
M438DRAFT_344936	Aureobasidium pullulans	M438DRAFT_344936	N
PV09_07689	Verruconis gallopava	PV09_07689	N