CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Lus10006590.g *(Linum usitatissimum)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	Lus10006590.g	T072013_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK05128.1 M01154_2.00	Cannabis sativa	NNNDBGTRKN	NMYACVHNNN	PBM Lambert et al.(2019) pTH10099	0.853	0.857
OS02G0266800 M10046_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$RITA1_01	0.830	0.651
CPRF2_PETCR M10069_2.00	Petroselinum crispum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CPRF2_01	0.811	0.810
CPRF2_PETCR M10070_2.00	Petroselinum crispum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CPRF2_Q2	0.811	0.810
estExt_Genewise1.C_2060077 M01832_2.00	Physcomitrella patens	NNHSACGTGKNN	NNMCACGTSDNN	PBM Weirauch et al.(2014) pTH8666	0.810	0.667
BZIP63 M01787_2.00	Arabidopsis thaliana	NNNWSACGTGKN	NMCACGTSWNNN	PBM Weirauch et al.(2014) pTH7300	0.792	0.683
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Lus10006590	bZIP	229	291	ADVKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLSDISHRYNQSSVDNR

Links
Other bZIP family TFs
Other *Linum usitatissimum* TFs