CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

PDK_20s1417191g003 *(Phoenix dactylifera)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	PDK_20s1417191g003	T073504_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
OS02G0266800 M10046_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$RITA1_01	0.865	0.905
PK05128.1 M01154_2.00	Cannabis sativa	NNNDBGTRKN	NMYACVHNNN	PBM Lambert et al.(2019) pTH10099	0.852	0.683
estExt_Genewise1.C_2060077 M01832_2.00	Physcomitrella patens	NNHSACGTGKNN	NNMCACGTSDNN	PBM Weirauch et al.(2014) pTH8666	0.808	0.603
CPRF2_PETCR M10069_2.00	Petroselinum crispum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CPRF2_01	0.795	0.619
CPRF2_PETCR M10070_2.00	Petroselinum crispum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CPRF2_Q2	0.795	0.619
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PDK_20s1417191g003	bZIP	75	152	SDLKRMRRMVSNRESARRSRKRKQAHLADLELQVDQLRGENASLFKQLTDANQQFTEAARDNRVLKSGVENLRVKVKM

Links
Other bZIP family TFs
Other *Phoenix dactylifera* TFs