CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Afo_R005099 *(Aptenodytes forsteri)* CxxC
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02008 (zf-CXXC)	IPR002857	Afo_R005099	T168559_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
KDM2A M01915_2.00	Meleagris gallopavo	NNNNYRNNNN	NNNNYRNNNN	PBM Weirauch et al.(2014) pTH9212	0.979	0.979
FBXL19 M01916_2.00	Tetraodon nigroviridis	NNNNCGNN	NNCGNNNN	PBM Weirauch et al.(2014) pTH8570	0.809	0.809
kdm2ba M01909_2.00	Danio rerio	NNNNCGN	NCGNNNN	PBM Weirauch et al.(2014) pTH8577	0.787	0.787
KDM2B M01911_2.00	Homo sapiens	NNNNNNCGN	NCGNNNNNN	PBM Weirauch et al.(2014) pTH9191	0.787	0.787
A6H8I1_DANRE M01906_2.00	Danio rerio	CGTACGYA	TRCGTACG	PBM Weirauch et al.(2014) pTH9257	0.766	0.766
kdm2aa M01910_2.00	Danio rerio	NCGNNNNNN	NNNNNNCGN	PBM Weirauch et al.(2014) pTH8585	0.702	0.702
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Afo_R005099	CxxC	557	603	GARRRRVRCRKCKACMQGECGMCHYCRDMKKFGGPGRMKQSCVLRQC

Links
Other CxxC family TFs
Other *Aptenodytes forsteri* TFs