CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

MDP0000244794 *(Malus domestica)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	MDP0000244794	T288475_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK05732.1 M01276_2.00	Cannabis sativa	HNATTCBNN	NNVGAATND	PBM Lambert et al.(2019) pTH11367	0.752	0.851
PHR1 M02302_2.00	Arabidopsis thaliana	NWKATNCBNN	NNVGNATMWN	PBM Weirauch et al.(2014) pTH7249	0.676	0.702
AT1G14600 M01268_2.00	Arabidopsis thaliana	NWAYATTCYN	NRGAATRTWN	PBM Lambert et al.(2019) pTH11557	0.665	0.702
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
MDP0000244794	Myb	33	84	RLRWTSQLHELFVEAVQSLGGKYKATPKRILQMMSVKGLEISHVKSHLQMYR

Links
Other Myb/SANT family TFs
Other *Malus domestica* TFs