CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

THAP12 *(Cavia porcellus)* THAP finger
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF05485 (THAP)	IPR006612	ENSCPOG00000013167	T348235_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
THAP12 M02538_2.00	Homo sapiens	NNNYMBNNBGRN	NYCVNNVKRNNN	PBM Weirauch et al.(2014) pTH9190	1.000	1.000
THAP12 M02539_2.00	Gallus gallus	NBNYCKGKMNNN	NNNKMCMGRNVN	PBM Weirauch et al.(2014) pTH8688	0.937	0.937
prkrirb M02536_2.00	Danio rerio	NNMCMGMSGGNN	NNCCSKCKGKNN	PBM Weirauch et al.(2014) pTH8319	0.899	0.899
prkrirb M02540_2.00	Oryzias latipes	NNBBCCGGNHN	NDNCCGGVVNN	PBM Weirauch et al.(2014) pTH9383	0.848	0.848
prkrirb M02541_2.00	Tetraodon nigroviridis	CCCGCGGG	CCCGCGGG	PBM Weirauch et al.(2014) pTH8574	0.848	0.848
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSCPOP00000011854	THAP finger	4	88	FCAAPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPTIFDL

Links
Other THAP finger family TFs
Other *Cavia porcellus* TFs