CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

OGLUM05G12430 *(Oryza glumaepatula)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	OGLUM05G12430	T353570_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY46 M07395_2.00	Arabidopsis thaliana	VAAAGTCAAMG	CKTTGACTTTB	Dap-seq OMalley et al.(2016) WRKY46_col_a	0.827	0.593
WRKY46 M07396_2.00	Arabidopsis thaliana	HRAAGTCAACG	CGTTGACTTYD	Dap-seq OMalley et al.(2016) WRKY46_colamp_a	0.827	0.593
WRKY70 M07399_2.00	Arabidopsis thaliana	HAAAGTCAACGNN	NNCGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY70_col	0.825	0.576
WRKY55 M07392_2.00	Arabidopsis thaliana	HWAGTCAACGNH	DNCGTTGACTWD	Dap-seq OMalley et al.(2016) WRKY55_col_a	0.810	0.610
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OGLUM05G12430.1	WRKY	118	178	DDGQAWRKYGQKEIQNSKHPKAYFRCTHKYDQLCTAQRQVQRCDDDPASYRVTYIGEHTCR

Links
Other WRKY family TFs
Other *Oryza glumaepatula* TFs